PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678358546
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 350aa    MW: 39764.2 Da    PI: 5.9866
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678358546genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.87.8e-082873202154
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                k +yp++e++++L +++gL+ +q+ +WF N+R +
  678358546 287 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 320
                569*****************************87 PP

2ELK28.53.5e-10241262122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELKh+L+++Y+ ++ ++++E++
  678358546 241 ELKHELKQGYKDKIADIREEIL 262
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.5E-1978122IPR005540KNOX1
PfamPF037901.8E-1680121IPR005540KNOX1
SMARTSM012565.1E-25128184IPR005541KNOX2
PfamPF037917.7E-18134183IPR005541KNOX2
SMARTSM011880.001241262IPR005539ELK domain
PROSITE profilePS5121310.109241261IPR005539ELK domain
PROSITE profilePS5007111.677261324IPR001356Homeobox domain
SuperFamilySSF466893.81E-16263327IPR009057Homeodomain-like
SMARTSM003893.5E-11263328IPR001356Homeobox domain
CDDcd000861.66E-11264323No hitNo description
Gene3DG3DSA:1.10.10.602.1E-25268325IPR009057Homeodomain-like
PfamPF059203.9E-18281320IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MAFQEPYPQT FHTQNQPQEI SFSHHSAPPP TLFDHPDDDK PQPSTWVNNT QWLPSTQSPT  60
STSKSSNDHH DGGNWERDKC KADVLNHPLY EELLSAHVAC LRIATPVDQL PRIDAQLAQS  120
HQVLAKYPLL GPPLDQKDLD QFMTHYVLLL SSFKEQLQQH VRVHAMEAVM ACWELEQSLQ  180
SLTGVAPGEG TGATMSDDDE EQVESENSLF DASLEGGDNM GFGPLVPTES ERTLMERVRQ  240
ELKHELKQGY KDKIADIREE ILRKRRAGKL PGDTTSVLKA WWQAHSKWPY PTEEDKARLV  300
QETGLQLKQI NNWFINQRKR NWHSNPSSSS SQKSKRKSVG GDKAGDERYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12264328872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084049.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X1
SwissprotP480001e-164KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0F6V0901e-169A0A0F6V090_POPTO; TALE transcription factor
STRINGVIT_04s0008g06130.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-155KNOTTED1-like homeobox gene 3